Lineage for d1nwpb_ (1nwp B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106648Protein Azurin [49530] (6 species)
  7. 106791Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)
  8. 106793Domain d1nwpb_: 1nwp B: [23012]

Details for d1nwpb_

PDB Entry: 1nwp (more details), 1.6 Å

PDB Description: crystallographic study of azurin from pseudomonas putida

SCOP Domain Sequences for d1nwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwpb_ b.6.1.1 (B:) Azurin {Pseudomonas putida}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

SCOP Domain Coordinates for d1nwpb_:

Click to download the PDB-style file with coordinates for d1nwpb_.
(The format of our PDB-style files is described here.)

Timeline for d1nwpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nwpa_