SCOPe 2.08: Domain d1nwpb_: 1nwp B:

Lineage for d1nwpb_ (1nwp B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)

8. Domain d1nwpb_: 1nwp B: [23012]
   complexed with cu, zn

Details for d1nwpb_

PDB Entry: 1nwp, 1.6 Å

PDB Description: crystallographic study of azurin from pseudomonas putida

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1nwpb_:

Sequence; same for both SEQRES and ATOM records:

>d1nwpb_ b.6.1.1 (B:) Azurin {Pseudomonas putida [TaxId: 303]}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

Timeline for d1nwpb_:

• d1nwpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nwpb_ appears in SCOPe 2.07