Lineage for d1nwpa_ (1nwp A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries) 
Domain d1nwpa_: 1nwp A: [23011]
Details for d1nwpa_
PDB Entry: 1nwp (more details), 1.6 Å
PDB Description: crystallographic study of azurin from pseudomonas putida
SCOP Domain Sequences for d1nwpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk
SCOP Domain Coordinates for d1nwpa_:
Click to download the PDB-style file with coordinates for d1nwpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nwpa_:
- d1nwpa_ appears in SCOP 1.57
- d1nwpa_ appears in the current release, SCOPe 2.08
View in 3D
