Lineage for d1nwpa_ (1nwp A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2366482Protein Azurin [49530] (6 species)
  7. 2366791Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)
  8. 2366792Domain d1nwpa_: 1nwp A: [23011]
    complexed with cu, zn

Details for d1nwpa_

PDB Entry: 1nwp (more details), 1.6 Å

PDB Description: crystallographic study of azurin from pseudomonas putida
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1nwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

SCOPe Domain Coordinates for d1nwpa_:

Click to download the PDB-style file with coordinates for d1nwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1nwpa_: