Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (342 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4l3cl_: 4l3c L: [230103] Other proteins in same PDB: d4l3ca1, d4l3ca2, d4l3cc1, d4l3cc2, d4l3ce1, d4l3ce2, d4l3cg1, d4l3cg2, d4l3ci1, d4l3ci2, d4l3ck1, d4l3ck2, d4l3cm1, d4l3cm2, d4l3co1, d4l3co2, d4l3cq1, d4l3cq2, d4l3cs1, d4l3cs2, d4l3cu1, d4l3cu2, d4l3cw1, d4l3cw2, d4l3cy1, d4l3cy2 automated match to d4fxla_ complexed with cl, gol; mutant |
PDB Entry: 4l3c (more details), 2.64 Å
SCOPe Domain Sequences for d4l3cl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l3cl_ b.1.1.2 (L:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekneyacrvnhvtlsqpkivkwdrdm
Timeline for d4l3cl_:
View in 3D Domains from other chains: (mouse over for more information) d4l3ca1, d4l3ca2, d4l3cb_, d4l3cc1, d4l3cc2, d4l3cd_, d4l3ce1, d4l3ce2, d4l3cf_, d4l3cg1, d4l3cg2, d4l3ch_, d4l3ci1, d4l3ci2, d4l3cj_, d4l3ck1, d4l3ck2, d4l3cm1, d4l3cm2, d4l3cn_, d4l3co1, d4l3co2, d4l3cp_, d4l3cq1, d4l3cq2, d4l3cr_, d4l3cs1, d4l3cs2, d4l3ct_, d4l3cu1, d4l3cu2, d4l3cv_, d4l3cw1, d4l3cw2, d4l3cx_, d4l3cy1, d4l3cy2, d4l3cz_ |