SCOPe 2.04: Domain d4l3cw2: 4l3c W:182-276

Lineage for d4l3cw2 (4l3c W:182-276)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d4l3cw2: 4l3c W:182-276 [230099]
   Other proteins in same PDB: d4l3ca1, d4l3cb_, d4l3cc1, d4l3cd_, d4l3ce1, d4l3cf_, d4l3cg1, d4l3ch_, d4l3ci1, d4l3cj_, d4l3ck1, d4l3cl_, d4l3cm1, d4l3cn_, d4l3co1, d4l3cp_, d4l3cq1, d4l3cr_, d4l3cs1, d4l3ct_, d4l3cu1, d4l3cv_, d4l3cw1, d4l3cx_, d4l3cy1, d4l3cz_
   automated match to d1ogaa1
   complexed with cl, gol; mutant

Details for d4l3cw2

PDB Entry: 4l3c, 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant

PDB Compounds: (W:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l3cw2:

Sequence; same for both SEQRES and ATOM records:

>d4l3cw2 b.1.1.2 (W:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d4l3cw2:

• d4l3cw2 first appeared in SCOPe 2.03
  
• d4l3cw2 appears in SCOPe 2.05
  
• d4l3cw2 appears in the current release, SCOPe 2.08