Lineage for d4l3cc1 (4l3c C:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1641866Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1641993Domain d4l3cc1: 4l3c C:1-181 [230091]
    Other proteins in same PDB: d4l3ca2, d4l3cb_, d4l3cc2, d4l3cd_, d4l3ce2, d4l3cf_, d4l3cg2, d4l3ch_, d4l3ci2, d4l3cj_, d4l3ck2, d4l3cl_, d4l3cm2, d4l3cn_, d4l3co2, d4l3cp_, d4l3cq2, d4l3cr_, d4l3cs2, d4l3ct_, d4l3cu2, d4l3cv_, d4l3cw2, d4l3cx_, d4l3cy2, d4l3cz_
    automated match to d1ogaa2
    complexed with cl, gol; mutant

Details for d4l3cc1

PDB Entry: 4l3c (more details), 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant
PDB Compounds: (C:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l3cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3cc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d4l3cc1:

Click to download the PDB-style file with coordinates for d4l3cc1.
(The format of our PDB-style files is described here.)

Timeline for d4l3cc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l3cc2