Lineage for d4klxa_ (4klx A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872364Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)
  8. 1872365Domain d4klxa_: 4klx A: [230075]
    automated match to d3d80a_
    complexed with atr, ete

Details for d4klxa_

PDB Entry: 4klx (more details), 1.23 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis in an open conformation.
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4klxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klxa_ c.71.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
shmvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplp
grrnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdig
lpreagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d4klxa_:

Click to download the PDB-style file with coordinates for d4klxa_.
(The format of our PDB-style files is described here.)

Timeline for d4klxa_: