SCOPe 2.06: Domain d4kmwb_: 4kmw B:

Lineage for d4kmwb_ (4kmw B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d4kmwb_: 4kmw B: [230072]
   automated match to d4kmwa_
   protein/RNA complex; complexed with hem, so4, t6c; mutant

Details for d4kmwb_

PDB Entry: 4kmw, 1.79 Å

PDB Description: structure of the y34n mutant of dehaloperoxidase-hemoglobin a from amphitrite ornata with 2,4,6-trichlorophenol

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4kmwb_:

Sequence; same for both SEQRES and ATOM records:

>d4kmwb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4kmwb_:

• d4kmwb_ first appeared in SCOPe 2.03
  
• d4kmwb_ appears in SCOPe 2.05
  
• d4kmwb_ appears in SCOPe 2.07
  
• d4kmwb_ appears in the current release, SCOPe 2.08