Lineage for d4kehb_ (4keh B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901881Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1901882Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 1901883Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 1901889Domain d4kehb_: 4keh B: [230070]
    Other proteins in same PDB: d4kehc_, d4kehd_
    automated match to d1mkaa_
    complexed with 1r3

Details for d4kehb_

PDB Entry: 4keh (more details), 1.9 Å

PDB Description: Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl Carrier Protein, AcpP
PDB Compounds: (B:) n-{3-[dihydroxy(nonyl)-lambda~4~-sulfanyl]propyl}-n~3~-[(2r)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alaninamide

SCOPe Domain Sequences for d4kehb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kehb_ d.38.1.2 (B:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
kresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldinp
dlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlptak
kvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqd

SCOPe Domain Coordinates for d4kehb_:

Click to download the PDB-style file with coordinates for d4kehb_.
(The format of our PDB-style files is described here.)

Timeline for d4kehb_: