Lineage for d4j0pa_ (4j0p A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2060484Domain d4j0pa_: 4j0p A: [230065]
    automated match to d3braa_
    complexed with 1h8, dms, na

Details for d4j0pa_

PDB Entry: 4j0p (more details), 1.97 Å

PDB Description: crystal structure of bace-1 in complex with 5-cyano-pyridine-2- carboxylic acid [3-((s)-2-amino-4-methyl-5,6-dihydro-4h-[1,3]oxazin- 4-yl)-4-fluoro-phenyl]-amide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4j0pa_:

Sequence, based on SEQRES records: (download)

>d4j0pa_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
egilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmi
iggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlr
lpkkvfeaavasikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqs
fritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfa
vsachvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d4j0pa_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
egilglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytg
slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaava
sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
rpvedvqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaa
vegpfvtldmedcgyn

SCOPe Domain Coordinates for d4j0pa_:

Click to download the PDB-style file with coordinates for d4j0pa_.
(The format of our PDB-style files is described here.)

Timeline for d4j0pa_: