Lineage for d4iske_ (4isk E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666674Protein Thymidylate synthase [55833] (7 species)
  7. 1666689Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)
  8. 1666728Domain d4iske_: 4isk E: [230060]
    automated match to d1f4ba_
    complexed with 1jy, mg, umc, ump

Details for d4iske_

PDB Entry: 4isk (more details), 1.75 Å

PDB Description: Crystal structure of E.coli thymidylate synthase with dUMP and the BGC 945 inhibitor
PDB Compounds: (E:) Thymidylate synthase

SCOPe Domain Sequences for d4iske_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iske_ d.117.1.1 (E:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d4iske_:

Click to download the PDB-style file with coordinates for d4iske_.
(The format of our PDB-style files is described here.)

Timeline for d4iske_: