Lineage for d1aznd_ (1azn D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043186Protein Azurin [49530] (6 species)
  7. 2043217Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
    Uniprot P00282
  8. 2043469Domain d1aznd_: 1azn D: [23006]
    complexed with cu; mutant

Details for d1aznd_

PDB Entry: 1azn (more details), 2.6 Å

PDB Description: crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d1aznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aznd_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctapghsal
mkgtltlk

SCOPe Domain Coordinates for d1aznd_:

Click to download the PDB-style file with coordinates for d1aznd_.
(The format of our PDB-style files is described here.)

Timeline for d1aznd_: