Lineage for d1aznd_ (1azn D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries) 
Domain d1aznd_: 1azn D: [23006]
Details for d1aznd_
PDB Entry: 1azn (more details), 2.6 Å
PDB Description: crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
SCOP Domain Sequences for d1aznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aznd_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctapghsal
mkgtltlk
SCOP Domain Coordinates for d1aznd_:
Click to download the PDB-style file with coordinates for d1aznd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aznd_:
- d1aznd_ appears in SCOP 1.57
- d1aznd_ appears in the current release, SCOPe 2.08
View in 3D
