Lineage for d4iskd_ (4isk D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666674Protein Thymidylate synthase [55833] (7 species)
  7. 1666689Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)
  8. 1666727Domain d4iskd_: 4isk D: [230057]
    automated match to d1f4ba_
    complexed with 1jy, mg, umc, ump

Details for d4iskd_

PDB Entry: 4isk (more details), 1.75 Å

PDB Description: Crystal structure of E.coli thymidylate synthase with dUMP and the BGC 945 inhibitor
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d4iskd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iskd_ d.117.1.1 (D:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d4iskd_:

Click to download the PDB-style file with coordinates for d4iskd_.
(The format of our PDB-style files is described here.)

Timeline for d4iskd_: