Lineage for d4iskb1 (4isk B:2-264)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578782Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)
  8. 2578819Domain d4iskb1: 4isk B:2-264 [230056]
    Other proteins in same PDB: d4iska2, d4iskb2, d4iskc2, d4iskd2, d4iske2, d4iskf2, d4iskg2, d4iskh2
    automated match to d1f4ba_
    complexed with 1jy, mg, umc, ump

Details for d4iskb1

PDB Entry: 4isk (more details), 1.75 Å

PDB Description: Crystal structure of E.coli thymidylate synthase with dUMP and the BGC 945 inhibitor
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4iskb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iskb1 d.117.1.1 (B:2-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
kqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihellw
flqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlkn
dpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfniasy
allvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesifd
yrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d4iskb1:

Click to download the PDB-style file with coordinates for d4iskb1.
(The format of our PDB-style files is described here.)

Timeline for d4iskb1: