Lineage for d4ijga2 (4ijg A:137-323)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.1: GAF domain [55782] (8 proteins) 
Protein Bacteriophytochrome BphP [160661] (3 species) Species Deinococcus radiodurans [TaxId:243230] [258261] (2 PDB entries) 
Domain d4ijga2: 4ijg A:137-323 [230055]
Other proteins in same PDB: d4ijga1
automated match to d2o9ba1
complexed with gol, lbv, peg, po4
Details for d4ijga2
PDB Entry: 4ijg (more details), 1.7 Å
PDB Description: Crystal structure of monomeric bacteriophytochrome
PDB Compounds: (A:) BacteriophytochromeSCOPe Domain Sequences for d4ijga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijga2 d.110.2.1 (A:137-323) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 243230]}
phalrnamsalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh
aflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrat
spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrelseqv
qvkeale
SCOPe Domain Coordinates for d4ijga2:
Click to download the PDB-style file with coordinates for d4ijga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ijga2:
- d4ijga2 first appeared in SCOPe 2.03
- d4ijga2 appears in SCOPe 2.07
View in 3D
