Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Bacteriophytochrome BphP [160661] (3 species) |
Species Deinococcus radiodurans [TaxId:243230] [258261] (2 PDB entries) |
Domain d4ijga2: 4ijg A:137-323 [230055] Other proteins in same PDB: d4ijga1 automated match to d2o9ba1 complexed with gol, lbv, peg, po4 |
PDB Entry: 4ijg (more details), 1.7 Å
SCOPe Domain Sequences for d4ijga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijga2 d.110.2.1 (A:137-323) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 243230]} phalrnamsalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh aflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrat spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrelseqv qvkeale
Timeline for d4ijga2: