Lineage for d4ip1a_ (4ip1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368271Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1368552Protein automated matches [190442] (11 species)
    not a true protein
  7. 1368565Species Escherichia coli [TaxId:83333] [197185] (3 PDB entries)
  8. 1368568Domain d4ip1a_: 4ip1 A: [230051]
    automated match to d1uc7a_
    mutant

Details for d4ip1a_

PDB Entry: 4ip1 (more details), 2.47 Å

PDB Description: c-terminal domain of the thiol:disulfide interchange protein dsbd, q488k mutant
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d4ip1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ip1a_ c.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
kanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqpg
l

SCOPe Domain Coordinates for d4ip1a_:

Click to download the PDB-style file with coordinates for d4ip1a_.
(The format of our PDB-style files is described here.)

Timeline for d4ip1a_: