Lineage for d4ip1a1 (4ip1 A:428-546)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876454Species Escherichia coli K-12 [TaxId:83333] [188760] (3 PDB entries)
  8. 2876457Domain d4ip1a1: 4ip1 A:428-546 [230051]
    Other proteins in same PDB: d4ip1a2
    automated match to d1uc7a_
    mutant

Details for d4ip1a1

PDB Entry: 4ip1 (more details), 2.47 Å

PDB Description: c-terminal domain of the thiol:disulfide interchange protein dsbd, q488k mutant
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d4ip1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ip1a1 c.47.1.1 (A:428-546) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
kanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp

SCOPe Domain Coordinates for d4ip1a1:

Click to download the PDB-style file with coordinates for d4ip1a1.
(The format of our PDB-style files is described here.)

Timeline for d4ip1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ip1a2