| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (13 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188760] (3 PDB entries) |
| Domain d4ip1a1: 4ip1 A:428-546 [230051] Other proteins in same PDB: d4ip1a2 automated match to d1uc7a_ mutant |
PDB Entry: 4ip1 (more details), 2.47 Å
SCOPe Domain Sequences for d4ip1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ip1a1 c.47.1.1 (A:428-546) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
kanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqp
Timeline for d4ip1a1: