Lineage for d4ig2b_ (4ig2 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341936Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 1341937Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)
  7. 1341938Species Pseudomonas fluorescens [TaxId:294] [141825] (10 PDB entries)
    Uniprot Q83V25 3-333
  8. 1341946Domain d4ig2b_: 4ig2 B: [230047]
    automated match to d4ifoa_
    complexed with zn

Details for d4ig2b_

PDB Entry: 4ig2 (more details), 1.8 Å

PDB Description: 1.80 Angstroms X-ray crystal structure of R51A and R239A heterodimer 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from Pseudomonas fluorescens
PDB Compounds: (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4ig2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ig2b_ c.1.9.15 (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfapvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffnin

SCOPe Domain Coordinates for d4ig2b_:

Click to download the PDB-style file with coordinates for d4ig2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ig2b_: