Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [141825] (14 PDB entries) Uniprot Q83V25 3-333 |
Domain d4ig2a_: 4ig2 A: [230046] automated match to d4ifka_ complexed with zn |
PDB Entry: 4ig2 (more details), 1.8 Å
SCOPe Domain Sequences for d4ig2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ig2a_ c.1.9.15 (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgavdn awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq kigglvlssnlgesakdkiisgnaskffnin
Timeline for d4ig2a_: