![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein Tryptophan synthase, beta-subunit [53688] (4 species) |
![]() | Species Salmonella enterica [TaxId:90371] [229810] (8 PDB entries) |
![]() | Domain d4hpjb_: 4hpj B: [230040] Other proteins in same PDB: d4hpja_ automated match to d4hpxb_ complexed with 1d0, bcn, cl, cs, f9f, peg |
PDB Entry: 4hpj (more details), 1.45 Å
SCOPe Domain Sequences for d4hpjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hpjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]} ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm mreqpekeqllvvnlsgrgdkdiftvhdilkarge
Timeline for d4hpjb_: