Lineage for d4hpjb_ (4hpj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907595Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2907612Species Salmonella enterica [TaxId:90371] [229810] (8 PDB entries)
  8. 2907614Domain d4hpjb_: 4hpj B: [230040]
    Other proteins in same PDB: d4hpja_
    automated match to d4hpxb_
    complexed with 1d0, bcn, cl, cs, f9f, peg

Details for d4hpjb_

PDB Entry: 4hpj (more details), 1.45 Å

PDB Description: crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4hpjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

SCOPe Domain Coordinates for d4hpjb_:

Click to download the PDB-style file with coordinates for d4hpjb_.
(The format of our PDB-style files is described here.)

Timeline for d4hpjb_: