Lineage for d4hjma_ (4hjm A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134831Species Plasmodium falciparum [TaxId:36329] [228276] (11 PDB entries)
  8. 2134836Domain d4hjma_: 4hjm A: [230036]
    automated match to d4mzca_
    complexed with mpd, mpo

Details for d4hjma_

PDB Entry: 4hjm (more details), 1.55 Å

PDB Description: crystal structure of glutaredoxin 1 from plasmodium falciparum (pfgrx1) solved by s-sad
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d4hjma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjma_ c.47.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdmaniqay
lkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn

SCOPe Domain Coordinates for d4hjma_:

Click to download the PDB-style file with coordinates for d4hjma_.
(The format of our PDB-style files is described here.)

Timeline for d4hjma_: