Lineage for d4h80g_ (4h80 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908891Protein automated matches [190401] (5 species)
    not a true protein
  7. 2908892Species Human (Homo sapiens) [TaxId:9606] [189906] (28 PDB entries)
  8. 2908954Domain d4h80g_: 4h80 G: [230033]
    automated match to d3szba_
    complexed with 04t

Details for d4h80g_

PDB Entry: 4h80 (more details), 2.5 Å

PDB Description: Crystal structure of human ALDH3A1 with its isozyme selective inhibitor - N-[4-(4-methylsulfonyl-2-nitroanilino)phenyl]acetamide
PDB Compounds: (G:) Aldehyde dehydrogenase, dimeric NADP-preferring

SCOPe Domain Sequences for d4h80g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h80g_ c.82.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy
eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt
iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf
dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg
qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq
kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp
lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet
fshrrsclvrplmndeglkvryppsp

SCOPe Domain Coordinates for d4h80g_:

Click to download the PDB-style file with coordinates for d4h80g_.
(The format of our PDB-style files is described here.)

Timeline for d4h80g_: