Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries) |
Domain d4h80f_: 4h80 F: [230031] automated match to d3szba_ complexed with 04t |
PDB Entry: 4h80 (more details), 2.5 Å
SCOPe Domain Sequences for d4h80f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h80f_ c.82.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet fshrrsclvrplmndeglkvryppsp
Timeline for d4h80f_: