Lineage for d4g8od_ (4g8o D:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1449808Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 1449809Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 1449810Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 1449975Protein automated matches [190484] (2 species)
    not a true protein
  7. 1449976Species Human (Homo sapiens) [TaxId:9606] [188559] (18 PDB entries)
  8. 1450008Domain d4g8od_: 4g8o D: [230020]
    automated match to d1a7ca_
    complexed with 96p, edo, so4

Details for d4g8od_

PDB Entry: 4g8o (more details), 2.71 Å

PDB Description: crystal structure of a novel small molecule inactivator bound to plasminogen activator inhibitor-1
PDB Compounds: (D:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d4g8od_:

Sequence, based on SEQRES records: (download)

>d4g8od_ e.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
hnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d4g8od_ e.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesvivsarmapeeiiidrpflfvvrhnptgtvlf
mgqvmep

SCOPe Domain Coordinates for d4g8od_:

Click to download the PDB-style file with coordinates for d4g8od_.
(The format of our PDB-style files is described here.)

Timeline for d4g8od_:

  • d4g8od_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-25
  • d4g8od_ appears in SCOPe 2.04
  • d4g8od_ appears in the current release, SCOPe 2.07, called d4g8od1