Lineage for d4g8od1 (4g8o D:5-379)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 2568376Domain d4g8od1: 4g8o D:5-379 [230020]
    Other proteins in same PDB: d4g8oa2, d4g8ob2, d4g8oc2, d4g8od2
    automated match to d1a7ca_
    complexed with 96p, edo, so4

Details for d4g8od1

PDB Entry: 4g8o (more details), 2.71 Å

PDB Description: crystal structure of a novel small molecule inactivator bound to plasminogen activator inhibitor-1
PDB Compounds: (D:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d4g8od1:

Sequence, based on SEQRES records: (download)

>d4g8od1 e.1.1.1 (D:5-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
dfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdsst
hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
dftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrh
nptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d4g8od1 e.1.1.1 (D:5-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
dfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdsst
hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
dftslsdqeplhvalalqkvkievnesvivsarmapeeiiidrpflfvvrhnptgtvlfm
gqvmep

SCOPe Domain Coordinates for d4g8od1:

Click to download the PDB-style file with coordinates for d4g8od1.
(The format of our PDB-style files is described here.)

Timeline for d4g8od1: