Lineage for d1ag0b_ (1ag0 B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106648Protein Azurin [49530] (6 species)
  7. 106677Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)
  8. 106771Domain d1ag0b_: 1ag0 B: [23002]

Details for d1ag0b_

PDB Entry: 1ag0 (more details), 2.4 Å

PDB Description: structure of cys 112 asp azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1ag0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag0b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv
vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa
lmkgtltlk

SCOP Domain Coordinates for d1ag0b_:

Click to download the PDB-style file with coordinates for d1ag0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ag0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ag0a_