Lineage for d4gbpa_ (4gbp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898797Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2898798Species Human (Homo sapiens) [TaxId:9606] [75277] (59 PDB entries)
    Uniprot P16442 64-345
  8. 2898858Domain d4gbpa_: 4gbp A: [230018]
    automated match to d3sxaa_
    complexed with gal, mn, udp

Details for d4gbpa_

PDB Entry: 4gbp (more details), 2.15 Å

PDB Description: crystal structure of bbbb+udp+gal at ph 10 with mpd as the cryoprotectant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d4gbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gbpa_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyva
flklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqdvsmrr
memisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyer
rpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnk
yllrhkptkvlspeylwdqqllgwpavlrklrftavpkn

SCOPe Domain Coordinates for d4gbpa_:

Click to download the PDB-style file with coordinates for d4gbpa_.
(The format of our PDB-style files is described here.)

Timeline for d4gbpa_: