Lineage for d4froa_ (4fro A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133522Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2133523Species Human (Homo sapiens) [TaxId:9606] [75277] (53 PDB entries)
    Uniprot P16442 64-345
  8. 2133568Domain d4froa_: 4fro A: [230007]
    automated match to d3sxaa_
    complexed with gal, gly, mn, udp

Details for d4froa_

PDB Entry: 4fro (more details), 1.75 Å

PDB Description: crystal structure of bbbb+udp+gal at ph 9.0 with mpd as the cryoprotectant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d4froa_:

Sequence, based on SEQRES records: (download)

>d4froa_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyva
flklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqdvsmrr
memisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyer
rpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnk
yllrhkptkvlspeylwdqqllgwpavlrklrftavpk

Sequence, based on observed residues (ATOM records): (download)

>d4froa_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyva
flklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqdvsmrr
memiscerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrp
qsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyl
lrhkptkvlspeylwdqqllgwpavlrklrftavpk

SCOPe Domain Coordinates for d4froa_:

Click to download the PDB-style file with coordinates for d4froa_.
(The format of our PDB-style files is described here.)

Timeline for d4froa_: