Lineage for d4bx0a_ (4bx0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149570Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2149573Domain d4bx0a_: 4bx0 A: [229998]
    automated match to d2hx1a_
    complexed with gol, mg

Details for d4bx0a_

PDB Entry: 4bx0 (more details), 1.75 Å

PDB Description: Crystal Structure of a Monomeric Variant of murine Chronophin (Pyridoxal Phosphate phosphatase)
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bx0a_:

Sequence, based on SEQRES records: (download)

>d4bx0a_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
srrarpelalrfarlgfaglraeqlfssalcaarllrqrlsgppdasgavfvlggeglra
elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
sdgsrtpgtgslakkvetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl

Sequence, based on observed residues (ATOM records): (download)

>d4bx0a_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
srrarpelalrfarlgfaglraeqlfssalcaarllrqrlsgpsgavfvlggeglraelr
aaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhplsdg
srtpgtgslakkvetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdilfg
hrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl

SCOPe Domain Coordinates for d4bx0a_:

Click to download the PDB-style file with coordinates for d4bx0a_.
(The format of our PDB-style files is described here.)

Timeline for d4bx0a_: