SCOPe 2.08: Domain d3wkmm2: 3wkm M:112-214

Lineage for d3wkmm2 (3wkm M:112-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3wkmm2: 3wkm M:112-214 [229993]
   Other proteins in same PDB: d3wkmh_, d3wkmi_
   automated match to d1g9ml2

Details for d3wkmm2

PDB Entry: 3wkm, 2.2 Å

PDB Description: The periplasmic PDZ tandem fragment of the RseP homologue from Aquifex aeolicus in complex with the Fab fragment

PDB Compounds: (M:) mouse igg1-kappa fab (light chain)

SCOPe Domain Sequences for d3wkmm2:

Sequence; same for both SEQRES and ATOM records:

>d3wkmm2 b.1.1.0 (M:112-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d3wkmm2:

• d3wkmm2 first appeared in SCOPe 2.03
  
• d3wkmm2 appears in SCOPe 2.07