SCOPe 2.08: Domain d3zfkb1: 3zfk B:450-573

Lineage for d3zfkb1 (3zfk B:450-573)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [229983] (1 PDB entry)

8. Domain d3zfkb1: 3zfk B:450-573 [229985]
   Other proteins in same PDB: d3zfka2, d3zfkb2
   automated match to d1m08a_
   complexed with act, cl, so4, zn

Details for d3zfkb1

PDB Entry: 3zfk, 1.7 Å

PDB Description: n-terminal truncated nuclease domain of colicin e7

PDB Compounds: (B:) Colicin-E7

SCOPe Domain Sequences for d3zfkb1:

Sequence; same for both SEQRES and ATOM records:

>d3zfkb1 d.4.1.1 (B:450-573) automated matches {Escherichia coli [TaxId: 469008]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkrh
idih

Timeline for d3zfkb1:

• d3zfkb1 first appeared in SCOPe 2.03, called d3zfkb_
  
• d3zfkb1 appears in SCOPe 2.07