![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (3 proteins) |
![]() | Protein automated matches [190311] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [229983] (1 PDB entry) |
![]() | Domain d3zfka1: 3zfk A:450-573 [229984] Other proteins in same PDB: d3zfka2, d3zfkb2 automated match to d1m08a_ complexed with act, cl, so4, zn |
PDB Entry: 3zfk (more details), 1.7 Å
SCOPe Domain Sequences for d3zfka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zfka1 d.4.1.1 (A:450-573) automated matches {Escherichia coli [TaxId: 469008]} pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkrh idih
Timeline for d3zfka1: