Lineage for d3zfka1 (3zfk A:450-573)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927849Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2927897Protein automated matches [190311] (2 species)
    not a true protein
  7. 2927898Species Escherichia coli [TaxId:469008] [229983] (1 PDB entry)
  8. 2927899Domain d3zfka1: 3zfk A:450-573 [229984]
    Other proteins in same PDB: d3zfka2, d3zfkb2
    automated match to d1m08a_
    complexed with act, cl, so4, zn

Details for d3zfka1

PDB Entry: 3zfk (more details), 1.7 Å

PDB Description: n-terminal truncated nuclease domain of colicin e7
PDB Compounds: (A:) Colicin-E7

SCOPe Domain Sequences for d3zfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zfka1 d.4.1.1 (A:450-573) automated matches {Escherichia coli [TaxId: 469008]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkrh
idih

SCOPe Domain Coordinates for d3zfka1:

Click to download the PDB-style file with coordinates for d3zfka1.
(The format of our PDB-style files is described here.)

Timeline for d3zfka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zfka2