Lineage for d2tsbd_ (2tsb D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224390Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 224416Protein Azurin [49530] (6 species)
  7. 224445Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)
  8. 224539Domain d2tsbd_: 2tsb D: [22998]
    complexed with azi, cu; mutant

Details for d2tsbd_

PDB Entry: 2tsb (more details), 2.3 Å

PDB Description: azurin mutant m121a-azide
PDB Compounds: (D:)

SCOP Domain Sequences for d2tsbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsbd_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
akgtltlk

SCOP Domain Coordinates for d2tsbd_:

Click to download the PDB-style file with coordinates for d2tsbd_.
(The format of our PDB-style files is described here.)

Timeline for d2tsbd_: