Lineage for d4nvtb_ (4nvt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2078930Species Brucella melitensis [TaxId:546272] [229966] (1 PDB entry)
  8. 2078932Domain d4nvtb_: 4nvt B: [229967]
    automated match to d3kxqa_

Details for d4nvtb_

PDB Entry: 4nvt (more details), 2.1 Å

PDB Description: Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4nvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvtb_ c.1.1.0 (B:) automated matches {Brucella melitensis [TaxId: 546272]}
irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwaigtgltptvqd
vraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadf
laicetyr

SCOPe Domain Coordinates for d4nvtb_:

Click to download the PDB-style file with coordinates for d4nvtb_.
(The format of our PDB-style files is described here.)

Timeline for d4nvtb_: