Lineage for d4nuwb_ (4nuw B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566456Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1566596Protein automated matches [190130] (11 species)
    not a true protein
  7. 1566687Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 1566805Domain d4nuwb_: 4nuw B: [229965]
    automated match to d3g1da_
    complexed with edo, gol, u5p

Details for d4nuwb_

PDB Entry: 4nuw (more details), 1.59 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4nuwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nuwb_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
dpgetlrfadaiivgrsiyladnpaaaaagiiesikdll

SCOPe Domain Coordinates for d4nuwb_:

Click to download the PDB-style file with coordinates for d4nuwb_.
(The format of our PDB-style files is described here.)

Timeline for d4nuwb_: