Lineage for d4nqna_ (4nqn A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320692Domain d4nqna_: 4nqn A: [229955]
    automated match to d3rcwf_
    complexed with y1z

Details for d4nqna_

PDB Entry: 4nqn (more details), 1.73 Å

PDB Description: Crystal Structure of the bromodomain of human BRD9 in complex with a triazolo-phthalazine ligand
PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d4nqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqna_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
estpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyk
svtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsm

SCOPe Domain Coordinates for d4nqna_:

Click to download the PDB-style file with coordinates for d4nqna_.
(The format of our PDB-style files is described here.)

Timeline for d4nqna_: