Lineage for d2tsba_ (2tsb A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162500Protein Azurin [49530] (6 species)
  7. 162529Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)
  8. 162620Domain d2tsba_: 2tsb A: [22995]

Details for d2tsba_

PDB Entry: 2tsb (more details), 2.3 Å

PDB Description: azurin mutant m121a-azide
PDB Compounds: (A:)

SCOP Domain Sequences for d2tsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsba_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
akgtltlk

SCOP Domain Coordinates for d2tsba_:

Click to download the PDB-style file with coordinates for d2tsba_.
(The format of our PDB-style files is described here.)

Timeline for d2tsba_: