![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
![]() | Superfamily c.110.1: DTD-like [69500] (3 families) ![]() active form is a dimer |
![]() | Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
![]() | Protein automated matches [190596] (6 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries) |
![]() | Domain d4nbjd_: 4nbj D: [229945] automated match to d3ko3e_ protein/RNA complex; complexed with d3y |
PDB Entry: 4nbj (more details), 2.2 Å
SCOPe Domain Sequences for d4nbjd_:
Sequence, based on SEQRES records: (download)
>d4nbjd_ c.110.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]} mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii defkkqynddkikigkfgnymnidvtndgpvtiyidthdinl
>d4nbjd_ c.110.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]} mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn ddkikigkfgnymnidvtndgpvtiyidthdinl
Timeline for d4nbjd_: