SCOPe 2.05: Domain d4n61c_: 4n61 C:

Lineage for d4n61c_ (4n61 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)

8. Domain d4n61c_: 4n61 C: [229935]
   Other proteins in same PDB: d4n61b_, d4n61d_
   automated match to d4bsea_
   complexed with nag, sia

Details for d4n61c_

PDB Entry: 4n61, 2.6 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with lsta, extended soaking

PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4n61c_:

Sequence; same for both SEQRES and ATOM records:

>d4n61c_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpeip

Timeline for d4n61c_:

• d4n61c_ first appeared in SCOPe 2.03
  
• d4n61c_ appears in SCOPe 2.04
  
• d4n61c_ appears in SCOPe 2.06
  
• d4n61c_ appears in the current release, SCOPe 2.08