Lineage for d4n62c_ (4n62 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (35 species)
    not a true protein
  7. 2371641Species Influenza A virus [TaxId:1332244] [228093] (13 PDB entries)
  8. 2371643Domain d4n62c_: 4n62 C: [229933]
    Other proteins in same PDB: d4n62b_, d4n62d_
    automated match to d4bsea_
    complexed with nag

Details for d4n62c_

PDB Entry: 4n62 (more details), 2.5 Å

PDB Description: Crystal structure of hemagglutinin from an H7N9 influenza virus in complex with a sulfated receptor analog
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4n62c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n62c_ b.19.1.0 (C:) automated matches {Influenza A virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpeip

SCOPe Domain Coordinates for d4n62c_:

Click to download the PDB-style file with coordinates for d4n62c_.
(The format of our PDB-style files is described here.)

Timeline for d4n62c_: