Class b: All beta proteins [48724] (174 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (8 species) not a true protein |
Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries) |
Domain d4n63c_: 4n63 C: [229931] automated match to d4bsea_ complexed with nag |
PDB Entry: 4n63 (more details), 2.75 Å
SCOPe Domain Sequences for d4n63c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n63c_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1332244]} dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpeip
Timeline for d4n63c_: