Lineage for d2tsac_ (2tsa C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries) 
Domain d2tsac_: 2tsa C: [22993]
Details for d2tsac_
PDB Entry: 2tsa (more details), 2.2 Å
PDB Description: azurin mutant m121a
SCOP Domain Sequences for d2tsac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tsac_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
akgtltlk
SCOP Domain Coordinates for d2tsac_:
Click to download the PDB-style file with coordinates for d2tsac_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tsac_:
- d2tsac_ appears in SCOP 1.57
- d2tsac_ appears in the current release, SCOPe 2.08
View in 3D
