Lineage for d4n5jc_ (4n5j C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2041025Species Influenza a virus [TaxId:1332244] [228093] (13 PDB entries)
  8. 2041045Domain d4n5jc_: 4n5j C: [229929]
    Other proteins in same PDB: d4n5jb_, d4n5jd_
    automated match to d4bsea_
    complexed with nag

Details for d4n5jc_

PDB Entry: 4n5j (more details), 2.7 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4n5jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5jc_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1332244]}
kiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtit
gppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgir
tngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstae
qtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfnga
fiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvk
qrslllatgmknvpeip

SCOPe Domain Coordinates for d4n5jc_:

Click to download the PDB-style file with coordinates for d4n5jc_.
(The format of our PDB-style files is described here.)

Timeline for d4n5jc_: