Lineage for d4n5ka_ (4n5k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386207Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries)
  8. 2386237Domain d4n5ka_: 4n5k A: [229928]
    Other proteins in same PDB: d4n5kb_, d4n5kd_
    automated match to d4bsea_
    complexed with nag, sia

Details for d4n5ka_

PDB Entry: 4n5k (more details), 2.71 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with lsta
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4n5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5ka_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpeip

SCOPe Domain Coordinates for d4n5ka_:

Click to download the PDB-style file with coordinates for d4n5ka_.
(The format of our PDB-style files is described here.)

Timeline for d4n5ka_: