Lineage for d4mz9c_ (4mz9 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314615Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1314716Protein ssDNA-binding protein [50264] (4 species)
  7. 1314719Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
    Uniprot P02339
  8. 1314726Domain d4mz9c_: 4mz9 C: [229924]
    automated match to d1eqqa_

Details for d4mz9c_

PDB Entry: 4mz9 (more details), 2.2 Å

PDB Description: Revised structure of E. coli SSB
PDB Compounds: (C:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d4mz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mz9c_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg

SCOPe Domain Coordinates for d4mz9c_:

Click to download the PDB-style file with coordinates for d4mz9c_.
(The format of our PDB-style files is described here.)

Timeline for d4mz9c_: