SCOP 1.61: Domain d2tsab_: 2tsa B:

Lineage for d2tsab_ (2tsa B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)

8. Domain d2tsab_: 2tsa B: [22992]

Details for d2tsab_

PDB Entry: 2tsa, 2.2 Å

PDB Description: azurin mutant m121a

SCOP Domain Sequences for d2tsab_:

Sequence; same for both SEQRES and ATOM records:

>d2tsab_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
akgtltlk

Timeline for d2tsab_:

• d2tsab_ first appeared (with stable ids) in SCOP 1.55
  
• d2tsab_ appears in SCOP 1.59
  
• d2tsab_ appears in SCOP 1.63
  
• d2tsab_ appears in the current release, SCOPe 2.08