Lineage for d4mq7a2 (4mq7 A:184-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370887Domain d4mq7a2: 4mq7 A:184-277 [229910]
    Other proteins in same PDB: d4mq7a1, d4mq7a3, d4mq7b_
    automated match to d3hujc2
    complexed with cis, nag

Details for d4mq7a2

PDB Entry: 4mq7 (more details), 2.6 Å

PDB Description: structure of human cd1d-sulfatide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mq7a2 b.1.1.0 (A:184-277) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d4mq7a2:

Click to download the PDB-style file with coordinates for d4mq7a2.
(The format of our PDB-style files is described here.)

Timeline for d4mq7a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mq7b_