SCOPe 2.04: Domain d4mq7a1: 4mq7 A:6-183

Lineage for d4mq7a1 (4mq7 A:6-183)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)

8. Domain d4mq7a1: 4mq7 A:6-183 [229908]
   Other proteins in same PDB: d4mq7a2, d4mq7b_
   automated match to d3hujc1
   complexed with cis, nag

Details for d4mq7a1

PDB Entry: 4mq7, 2.6 Å

PDB Description: structure of human cd1d-sulfatide

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mq7a1:

Sequence, based on SEQRES records:

>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Sequence, based on observed residues (ATOM records):

>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhnnffhvafqgkdilsfqgts
weptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d4mq7a1:

• d4mq7a1 first appeared in SCOPe 2.03
  
• d4mq7a1 appears in SCOPe 2.05
  
• d4mq7a1 appears in the current release, SCOPe 2.08